Apakah Kamu Tahu I

  1. Bahwa gerak hanyalah ilusi dan waktu hanyalah sebuah konsep.....
  2. Sel2x tubuh manusia menyelesaikan regenerasinya yang baru setiap 72 jam.....
  3. Islandia itu berwarna hijau dan Greenland tertutup dengan es.....
  4. Lempeng bumi bergerak 0,007 Cm setiap harinya......
  5. Rata2x orang di Amerika memiliki 2 kartu kredit dan dijepang rata2x setiap orang memiliki 5 kartu kredit......
  6. Dalam 4.000 thn terakhir ini hanya Sapi yang tidak mengalami perubahan genetik......
  7. Tulisan Cina untuk "MASALAH" adalah gambar 2 wanita tinggal diatap rumah yang sama.
  8. Tulisan Cina untuk "KRISIS" dan "KESEMPATAN" adalah sama.
  9. Zaier adalah penghasil Cobalt terbesar didunia, 2/3 produksi cobalt dihasilkan di Zaire.
  10. "IBM COMPATIBLE" tidak 100 % compatible kecuali dia dapat menjalankan MIRCOSOFT FLIGHT SIMULATOR.
  11. SemuaAngsa di Inggris adalah Properti dari Ratu dan mengangu merekamerupakan sebuah pelanggaran berat dengan sanksi hukuman penjara.
  12. Leonardo Da Vinci yang menciptakan gunting modern.
  13. Satu2xnya binatang yang telah dijinakan dan tidak disebutkan didalam Alkitab adalah kucing.
  14. MarkTwain lahir dihari dimana komet halley melintas dan dia meninggal 76thn berikutnya tepat dihari dimana komet halley melintas lagi.
  15. Hard Drive pertama yang diciptakan memiliki kapasitas terbesar adalah 5 MB dan berharga $ 45.000
  16. Pada versi originalnya, Cerita 1001 satu malam dimulai dengan "Alladin seorang bocah cina...."
  17. Menurut survei unesco thn 1996, nama yang paling umum dipakai didunia adalah Mohammed.
  18. Kata2x "Set" adalah kata2x yang memiliki arti paling banyak didalam kamus bahasa inggris keluaran Oxford.
  19. Ikan dari Capt.Jean Luc Picard bernama Livingston dan Kucing dari Lt.Data bernama Spot.
  20. GasHydrogen adalah unsur yang paling ringan yang ada didunia ini yaitu0.08988 g/cc dan hidrogen padat adalah yang terberat didunia ini yaitu70.6 g/cc.
  21. Singapore adalah satu2xnya negara dengan 1 stasiun kereta api.
  22. Leeuwarden, sebuah kota dibelanda dapat di lafalkan dengan 255 cara berbeda.
  23. Kata2x yang tertua dan tidak berubah maknanya dalam bahasa inggris adalah "TOWN"
  24. Nama2x benua didunia selalu diawali dan diakhiri oleh hurup yang sama dalam bahasa inggris.
  25. Menurutteori relativitas einstein bahwa dimungkinan untuk bergerak lebihlambat atau lebih cepat daripada kecepatan cahaya tetapi tidak mungkindapat bergerak sama dengan kecepatan cahaya.
  26. Nama tengah dari Donald Duck adalah Fintleroy.
  27. Bill Gates di Gaji 1 $ setiap bulannya untuk berkerja di Microsoft.
  28. 10 tahun lalu wanita di dunia rata2 ukuran itunya 36B, sekarang sudah 36C
  29. Kembang api, roket, argometer ditemukan oleh org cina yang secara prinsipil sampe skrg ngga berubah
  30. Kebanyakan orang secara tidak sadar lebih sering bebelok kesebelah kanan dibanding kesebelah kiri ketika berjalan.
  31. Lebih banyak orang yang meninggal akibat tersedak dibandingkan mereka yang meninggal karena penyakit jantung koroner.
  32. Kemungkinan orang tersambar petir digurun Nevada lebih besar dibandingkan dengan memenangkan lotto jackpot.
  33. Seekora capung hanya memiliki rata2x waktu hidup 24 jam saja. Dan seekor ikan mas hanya memiliki 3 detik saja ingatan diotaknya.
  34. Padasebuah pertandingan antara Liverpool dan Chester City dithn 68 yangberakhir dengan skor 2-2, ke 4 Gol itu diciptakan oleh orang yang sama.
  35. Pertandingandengan penalti terburuk adalah antara Steau bucharest dan barcelonapada Piala champion thn 85/86. dari 10 tendangan, 8 berhasil ditahankiper dan 2 berhasil pada putaran ke 3 penalti (Artinya 20 penaltisebelumnya tidak ada satupun yang masuk kegawang)
  36. Nama terpanjang di dunia itu datangnya dr Thailand yaitu: "Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwesmahasatarnamornpimarnavatarsatitsakattiyavisanukamph rasit" Thetranslation here is pretty much the unabridged history of the cityrather than a word: krungthep mahanakhon = The land of angels, thegreat city of; amorn rattanakosin = immortality, various of devinegems; mahintara yudthaya mahadilok pohp = the great angelic landunconquerable; noparat rajathanee bureerom = land of nine noble gems,the royal city, the pleasant capital; udomrajniwes mahasatarn = placeof the grand royal palace; amorn pimarn avaltarnsatit = forever land ofangels and reincarnated spirits; sakatattiya visanukram prasit =predestined and created by the highest devas.
  37. 99% manusia tidak dapat menjilati sikunya sendiri.
  38. 90% orang yang telah membaca kalimat di atas akan mencoba menjilati sikunya sendiri.
  39. Kecoa itu dapat bertahan dari radiasi nuklir
  40. Kucingkampung mendengkur setiap 26 kali per detik, sama dengan frekwensimesin disel dalam keadaan idle. Kucing kampung dapat mendengarfrekswensi suara hingga 65 kHz, sedangkan manusia hingga 20 kHz.Kemampuan indera penciumannya 14 kali lebih kuat daripada penciumanmanusia.
  41. Kucing kampung - atau jenis kucing apapun juga -tidak mempunyai 9 nyawa cadangan. Mereka juga tidak selalu mendaratdengan ujung kakiknya. Dikatakan bahwa seekor kucing yang jatuh daritingkat 20 mempunyai kemungkinan selamat lebih besar dibanding denganyang jatuh dari tingkat 7, karena seekor kucing membutuhkan ketinggiansekurangnya 7 lantai untuk dapat mengatur tubuhnya agar dapat mendaratdengan kakinya.
  42. Kucing melangkah dengan kedua kaki kirinya,sedangkan pada saat berlari menggunakan kedua kaki kanannya.Satu-satunya binatang yang melakukan hal ini adalah jerapah dan onta.
  43. Jantung kita berdenyut rata2 100,000 denyutan/hari
  44. Rata2 manusia mengedipkan mata adalah 6,205,000 setiap tahunnya
  45. Disaat seseorang bersin,dapat mencapai kecepatan 100 m.p.h
  46. Bagian tubuh yg akan selalu tumbuh adalah kuping dan hidung
  47. Gigi adalah satu2nya bagian tubuh yg tidak bisa memperbaiki dengan sendirinya.
  48. Detak jantung anjing antara 70-120 permenit sedangkan manusia hanya sekitar 70-80 permenit.
  49. Kebanyakananjing hanya mampu berlari dengan kecepatan 30,5 km/jam sedangkananjing trah Greyhound dapat berlari dengan kecepatan 64 km/jam. Pantassaja kalau trah ini disebut dengan rajanya anjing pelari.
  50. Anjing dengan ukuran terbesar adalah Irish Wolfhound.
  51. Anjing dengan ukuran tubuh terkecil adalah Chihuahua, sementara untuk ukuran berat badan terberat adalah Saint Bernard.
  52. Anjingterkecil yang pernah tercatat dalam sejarah adalah seekor YorkshireTerrier yang berasal dari Blackburn (Inggris). Pada saat berumur 2tahun hanya memiliki tinggi tubuh 6,35 cm, panjang tubuh 9,5 cm danberat tubuh 113 gram!!!
  53. Anjing yang pernah hidup paling lamayang tercatat dalam sejarah adalah seekor anjing Australian cattle-dogyang bernama Bluey. Bluey diČtidurkanČ pada usia 29 tahun dan 5 bulan!!!
  54. Anjing terberat dan terpanjang yang pernah tercatatsepanjang sejarah adalah Old English Mastiff yang bernama Zorba. Diamemiliki bobot badan 155 kg dan memiliki panjang 3,1 meter diukur dariujung hidung sampai ujung ekor.
  55. Anjing dengan ukuran tertinggiyang pernah tercatat dalam sejarah adalah anjing trah Great Dane dengannama Shamgret Danzas. Dia memiliki tinggi 1,06 meter yang diukur daripundak dan memiliki berat tubuh 108 kg.
  56. Anjing trah Dalmatiantidak lahir dengan totol-totol hitamnya. Ketika lahir mereka hanyamemiliki warna putih saja pada bulu mereka. Setelah dua minggu totolhitamnya baru akan muncul.
  57. Ada persamaan antara anjing danburung jika memberikan makan pada anak-anakanya yang masih belum bisamencari makan sendiri. Setelah makan kenyang, anjing akan menghampirisarangnya dan akan memuntahkan sebagian isi perutnya untuk dimakan olehanak-anak mereka.
  58. Sendawa pertama yang pernah tersiarkan secara nasional adalah di tahun 1935.
  59. Tikus ML cuma bertahan 5 detik !!!
  60. Dibutuhkan kulit dari 3000 sapi untuk bikin bola football bermerk NFL per tahunnya
  61. Presiden Benjamin Harrison ternyata takut untuk menyentuh saklar
  62. Kalo para cowo Jepang mo bikin sumpah, mereka kencing bareng dan saling menyilangkan air kencingnya yang memancur
  63. Ternyata ada 170,000,000,000,000,000,000,000,000 jalan yang bisa dimainkan pada 10 langkah awal dalam sebuah permainan catur
  64. Ternyata juga, Walt Disney itu takut lho sama tikus
  65. 08. 85% telfon bertemakan cabul dilakukan oleh PRIA
  66. Kuku manusia terbuat dari bahan yang sama dengan bahan pada paruh burung
  67. Piala Oscar yang diberikan pada masa Perang Dunia II ternyata terbuat dari plester/plastik karena saat itu logam sangat langka
  68. Manusiatertua yang pernah tercatat (dalam Guinness Book of World Records)adalah Jeanne Louise Calment, seorang wanita berkebangsaan Prancis. Ialahir pada tanggal 21 Februari 1875 dan meninggal pada tanggal 4Agustus 1997 dalam umur 122 tahun 164 hari
  69. Kemudian, tahukah kamu? Bahwa dia itu seorang perokok dan baru berhenti merokok saat berumur 117 tahun.
  70. Negara Republik Siprus memiliki lagu kebangsaan yang sama dengan lagu kebangsaan Yunani.
  71. Lagukebangsaan yang berjudul "Imnos is tin Eleftherian" itu merupakan lagukebangsaan terpanjang di dunia, yang terdiri atas 158 bait, dan setiapbait terdapat 8 baris.
  72. Lagu kebangsaan negara Liechenstein,yaitu "Oben am jungen Rhein" mempunyani nada yang sama persis denganlagu kebangsaan Inggris, "God Save the Queen".
  73. AmerikaSerikat adalah negara yang paling banyak/sering mengganti desainbendera nasionalnya. Sejak merdeka Amerika Serikat telah menggantidesain benderanya sebanyak 26 kali, terakhir kali dilakukan pada 4 Juli1960.
  74. Warna yang paling banyak digunakan dalambendera-bendera negara adalah warna merah, dan simbol yang palingbanyak dipakai adalah simbol bintang.
  75. Bagian belakang bendera Paraguay mempunyai simbol yang berbeda dengan bagian depannya.
  76. Mata uang tertinggi di dunia adalah Kuwait Dinar (KWD), dengan nilai:1 KWD = 3,40 USD = 31.170,00 IDR
  77. Mata uang terndah di dunia adalah Zimbabwe Dollar (ZWD), dengan nilai:1 USD = 99.200,00 ZWD1 IDR = 10,80 ZWD
  78. Indonesia Rupiah (IDR) adalah mata uang terendah ke-5 di dunia
  79. Kamu nggak pernah bisa mengikat tali sepatu sama kencangnya antara tali sepatu kiri dan tali sepatu kanan
  80. PulauJawa adalah pulau dengan penduduk terbanyak sekaligus terpadat didunia. Jumlah penduduknya 127.000.000 jiwa dan kepadatan penduduknya962 jiwa/km2.
  81. Rotasi Planet Venus sangat lambat sehinggaperiode rotasinya lebih lama dibandingkan periode revolusinya. Tidakseperti planet pada umumnya, rotasi Planet Venus bergerak dari arahtimur ke barat, sehingga JIKA kamu berada di Venus, kamu akan melihatmatahari terbit di sebelah barat dan terbenam di sebelah timur.
  82. Nama tempat paling panjang di Bumi yang diketahui adalah :Llanfairpwllgwyngyllgogerychwyrndrobwllllantysilio gogogochTerletak di barat laut Wales, United Kingdom. Tetapi kebanyakan orang sering memanggilnya secara mudah sebagai Llanfair PG
  83. Dalamkeaadan berbaring daya kreativitas lebih tinggi (dibanding duduk) ? dlmkeadaan duduk terjadi tekanan darah yg lbh tinggi pada bagian kepala,leher, punggung. hal ini menyebabkan reseptor tekanan dlm dindingpembuluh darah aktiv, yg berakibat daya guna otak menurun &ketegangan.
  84. San francisco adl kota dengan homo seksual ter tinggi. 40% lakinya tukang sodok belakang (alias maen anggar) ""
  85. Sebuah bola baseball memiliki tepat 108 jahitan, sebuah bola untuk sepakbola memiliki 642 jahitan
  86. Dimanakah tempat terpanas di bumi ? Di El Azizia di Libya.Suhunya pernah mencapai 57.8 Celcius pada bulan September 1922.
  87. Dimanakah tempat terdingin di bumi ? Di Vostok, Antartika.Suhunya pernah mencapai -89 Celsius pada bulan Juli 1983.
  88. Lampulalu lintas pertama kali ada di persimpangan London tahun 1868, berisigas yang diselubungi kurungan warna merah dan hijau. Kemudian padatahun 1920 ada yang lebih modern diciptakan oleh Garrett AugustusMorgan di Detroit Amerika Serikat untuk signal kereta api yangselanjutnya ia patenkan dan kita gunakan hingga kini.
  89. Merokokdapat mengurangi massa tulang, terganggunya system hormonal terutamaEstrogen pada Wanita sehingga menyebabkan Menopause dini .
  90. Ternyata dari hasil penelitian bahwa makan terlalu banyak Protein dan garam dapat mengakibatkan penipisan kalsium pada tulang.
  91. Kopi,teh, minuman soda ternyata dapat menyebabkan tubuh kehilangan banyakkandungan kalsium di bandingkan dengan orang - orang yang jarang minumkopi ,teh atau minuman soda...!?
  92. Ketika baru lahir, kamu hanyamemiliki 300 tulang. Seiring dengan bertambah besar, beberapa daritulang ini mulai menyatu. Hasilnya? Orang dewasa memiliki hanya 206tulang.
  93. Tahukah kamu bahwa manusia dan jerapah memiliki jumlahtulang yang sama di lehernya? Sementara leher mereka jauh lebih panjangdari kita, yah?
  94. 96 persen mahluk hidup di Bumi tidak memilikitulang belakang. Tapi mereka yang memiliki tulang belakang memilikibanyak persamaan: tengkorak yang mengelilingi otak, tulang rusuk untukmelindungi jantung dan tulang rahang atau tulang mulut.
  95. Kalsiumadalah sahabat terbaik tulang. Karena itu, banyak-banyaklah mengonsumsimakanan yang mengandung kalsium. Seperti susu. Sehingga tulangmu tetapsehat dan kuat
  96. Obat yang dianggap sebagai obat dewa yaitukortison ternyata dapat menyebabkan keropos tulang atau yang dikenaldengan Osteoporosis dan memperlambat pertumbuhan tulang.
  97. Tahukah kamu bahwa lidah kita mempunyai kurang lebih 10.000 indra perasa untuk mencicipi masakan yang sedaaap ....!!
  98. Kebiasaanminum Alkohol sangat tidak ada faedahnya, karena dapat menjadiketagihan , merusak sel Hati / lever sehingga dapat menyebabkan sirosisHati dan juga osteoporosis dini
  99. Saat ini juga di otak anda sedang terjadi jutaan reaksi kimia yang berbeda.
  100. Dejavu bukanlah mengingat kembali kejadian yang pernah terjadi melainkanterjadinya kerusakan sementara beberapa sel yang menyebabkan andamerasa mengingat kembali suatu yang tak pernah terjadi sebelumnya